Lineage for d1fhsa_ (1fhs A:)

  1. Root: SCOPe 2.07
  2. 2494617Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2530460Fold d.93: SH2-like [55549] (1 superfamily)
    3 layers: a/b/a; antiparallel beta-sheet of 5 strands is flanked by two helices
  4. 2530461Superfamily d.93.1: SH2 domain [55550] (2 families) (S)
  5. 2530462Family d.93.1.1: SH2 domain [55551] (35 proteins)
    Pfam PF00017
  6. 2530616Protein Growth factor receptor-bound protein 2 (GRB2) [55563] (1 species)
  7. 2530617Species Human (Homo sapiens) [TaxId:9606] [55564] (38 PDB entries)
  8. 2530682Domain d1fhsa_: 1fhs A: [40488]

Details for d1fhsa_

PDB Entry: 1fhs (more details)

PDB Description: the three-dimensional solution structure of the src homology domain-2 of the growth factor receptor bound protein-2, nmr, 18 structures
PDB Compounds: (A:) growth factor receptor bound protein-2

SCOPe Domain Sequences for d1fhsa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1fhsa_ d.93.1.1 (A:) Growth factor receptor-bound protein 2 (GRB2) {Human (Homo sapiens) [TaxId: 9606]}
giemkphpwffgkiprakaeemlskqrhdgafliresesapgdfslsvkfgndvqhfkvl
rdgagkyflwvvkfnslnelvdyhrstsvsrnqqiflrdieqvpqqptyvqa

SCOPe Domain Coordinates for d1fhsa_:

Click to download the PDB-style file with coordinates for d1fhsa_.
(The format of our PDB-style files is described here.)

Timeline for d1fhsa_: