Class a: All alpha proteins [46456] (285 folds) |
Fold a.1: Globin-like [46457] (2 superfamilies) core: 6 helices; folded leaf, partly opened |
Superfamily a.1.1: Globin-like [46458] (5 families) |
Family a.1.1.2: Globins [46463] (27 proteins) Heme-binding protein |
Protein Hemoglobin, beta-chain [46500] (24 species) |
Species Maned wolf (Chrysocyon brachyurus) [TaxId:68728] [63441] (1 PDB entry) |
Domain d1fhjb_: 1fhj B: [59838] Other proteins in same PDB: d1fhja_, d1fhjc_ complexed with hem |
PDB Entry: 1fhj (more details), 1.8 Å
SCOPe Domain Sequences for d1fhjb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1fhjb_ a.1.1.2 (B:) Hemoglobin, beta-chain {Maned wolf (Chrysocyon brachyurus) [TaxId: 68728]} vhltaeekslvsglwgkvnvdevggealgrllivypwtqrffdsfgdlstpdavmsnakv kahgkkvlnsfsdglknldnlkgtfaklselhcdklhvdpenfkllgnvlvcvlahhfgk eftpqvqaayqkvvagvanalahkyh
Timeline for d1fhjb_: