Lineage for d1fh0a_ (1fh0 A:)
- Root: SCOPe 2.04
Class d: Alpha and beta proteins (a+b) [53931] (380 folds) 
Fold d.3: Cysteine proteinases [54000] (1 superfamily)
consists of one alpha-helix and 4 strands of antiparallel beta-sheet and contains the catalytic triad Cys-His-AsnSuperfamily d.3.1: Cysteine proteinases [54001] (23 families) 
the constitute families differ by insertion into and circular permutation of the common catalytic core made of one alpha-helix and 3-strands of beta-sheet
Family d.3.1.1: Papain-like [54002] (26 proteins) 
Protein (Pro)cathepsin V [64202] (1 species) Species Human (Homo sapiens) [TaxId:9606] [64203] (3 PDB entries) 
Domain d1fh0a_: 1fh0 A: [59832]
complexed with 0iw, so4
Details for d1fh0a_
PDB Entry: 1fh0 (more details), 1.6 Å
PDB Description: crystal structure of human cathepsin v complexed with an irreversible vinyl sulfone inhibitor
PDB Compounds: (A:) cathepsin vSCOPe Domain Sequences for d1fh0a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1fh0a_ d.3.1.1 (A:) (Pro)cathepsin V {Human (Homo sapiens) [TaxId: 9606]}
lpksvdwrkkgyvtpvknqkqcgscwafsatgalegqmfrktgklvslseqnlvdcsrpq
gnqgcnggfmarafqyvkenggldseesypyvavdeickyrpensvaqdtgftvvapgke
kalmkavatvgpisvamdaghssfqfyksgiyfepdcssknldhgvlvvgygfegansdn
skywlvknswgpewgsngyvkiakdknnhcgiataasypnv
SCOPe Domain Coordinates for d1fh0a_:
Click to download the PDB-style file with coordinates for d1fh0a_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1fh0a_:
- d1fh0a_ first appeared in SCOP 1.57
- d1fh0a_ appears in SCOPe 2.03
- d1fh0a_ appears in SCOPe 2.05
- d1fh0a_ appears in the current release, SCOPe 2.08
View in 3D
