Lineage for d1ffkj_ (1ffk J:)

  1. Root: SCOPe 2.01
  2. 968085Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 980515Fold c.12: Ribosomal proteins L15p and L18e [52079] (1 superfamily)
    core: three turns of irregular (beta-beta-alpha)n superhelix
  4. 980516Superfamily c.12.1: Ribosomal proteins L15p and L18e [52080] (1 family) (S)
  5. 980517Family c.12.1.1: Ribosomal proteins L15p and L18e [52081] (2 proteins)
  6. 980518Protein Ribosomal protein L15 (L15p) [52082] (4 species)
  7. 980556Species Haloarcula marismortui [TaxId:2238] [52083] (40 PDB entries)
    Uniprot P12737
  8. 980596Domain d1ffkj_: 1ffk J: [30880]
    Other proteins in same PDB: d1ffk11, d1ffk12, d1ffka1, d1ffka2, d1ffkb_, d1ffkc_, d1ffkd_, d1ffke_, d1ffkf_, d1ffkg_, d1ffkh_, d1ffki_, d1ffkk_, d1ffkl_, d1ffkm_, d1ffkn_, d1ffko_, d1ffkp_, d1ffkq_, d1ffkr_, d1ffks_, d1ffkt_, d1ffku_, d1ffkv_, d1ffkw_, d1ffkx_, d1ffky_, d1ffkz_
    complexed with cd, k, mg

Details for d1ffkj_

PDB Entry: 1ffk (more details), 2.4 Å

PDB Description: crystal structure of the large ribosomal subunit from haloarcula marismortui at 2.4 angstrom resolution
PDB Compounds: (J:) ribosomal protein l15

SCOPe Domain Sequences for d1ffkj_:

Sequence, based on SEQRES records: (download)

>d1ffkj_ c.12.1.1 (J:) Ribosomal protein L15 (L15p) {Haloarcula marismortui [TaxId: 2238]}
tskkkrqrgsrthgggshknrrgaghrggrgdagrdkhefhnheplgksgfkrpqkvqee
aatidvreidenvtllaaddvaevedggfrvdvrdvveeaddadyvkvlgagqvrheltl
iaddfsegarekvegaggsveltdlgeerqa

Sequence, based on observed residues (ATOM records): (download)

>d1ffkj_ c.12.1.1 (J:) Ribosomal protein L15 (L15p) {Haloarcula marismortui [TaxId: 2238]}
tskkkrqrgsrthgggshknrrgaghrggrgdagrdkhefhnheplgksgfkrpqkvqee
aatidvreidenvtllaaddvaedvrdvveeaddadyvkvlgagqvrheltliaddfseg
arekvegaggsveltdlgeerqa

SCOPe Domain Coordinates for d1ffkj_:

Click to download the PDB-style file with coordinates for d1ffkj_.
(The format of our PDB-style files is described here.)

Timeline for d1ffkj_: