![]() | Class d: Alpha and beta proteins (a+b) [53931] (376 folds) |
![]() | Fold d.141: Ribosomal protein L6 [56052] (1 superfamily) consists of two beta-sheets and one alpha-helix packed around single core |
![]() | Superfamily d.141.1: Ribosomal protein L6 [56053] (1 family) ![]() |
![]() | Family d.141.1.1: Ribosomal protein L6 [56054] (1 protein) |
![]() | Protein Ribosomal protein L6 [56055] (6 species) duplication: consists of two domains of this fold |
![]() | Species Archaeon Haloarcula marismortui [TaxId:2238] [56057] (40 PDB entries) Uniprot P14135 |
![]() | Domain d1ffk11: 1ffk 1:1-79 [41475] Other proteins in same PDB: d1ffka1, d1ffka2, d1ffkb_, d1ffkc_, d1ffkd_, d1ffke_, d1ffkf_, d1ffkg_, d1ffkh_, d1ffki_, d1ffkj_, d1ffkk_, d1ffkl_, d1ffkm_, d1ffkn_, d1ffko_, d1ffkp_, d1ffkq_, d1ffkr_, d1ffks_, d1ffkt_, d1ffku_, d1ffkv_, d1ffkw_, d1ffkx_, d1ffky_, d1ffkz_ CA-atoms only |
PDB Entry: 1ffk (more details), 2.4 Å
SCOP Domain Sequences for d1ffk11:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ffk11 d.141.1.1 (1:1-79) Ribosomal protein L6 {Archaeon Haloarcula marismortui [TaxId: 2238]} prveleipedvdaeqdhlditvegdngsvtrrlwypdidvsvdgdtvviesdednaktms tigtfqshienmfhgvteg
Timeline for d1ffk11:
![]() Domains from other chains: (mouse over for more information) d1ffka1, d1ffka2, d1ffkb_, d1ffkc_, d1ffkd_, d1ffke_, d1ffkf_, d1ffkg_, d1ffkh_, d1ffki_, d1ffkj_, d1ffkk_, d1ffkl_, d1ffkm_, d1ffkn_, d1ffko_, d1ffkp_, d1ffkq_, d1ffkr_, d1ffks_, d1ffkt_, d1ffku_, d1ffkv_, d1ffkw_, d1ffkx_, d1ffky_, d1ffkz_ |