Lineage for d1fb0a_ (1fb0 A:)
- Root: SCOPe 2.08
Class c: Alpha and beta proteins (a/b) [51349] (148 folds) 
Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the restSuperfamily c.47.1: Thioredoxin-like [52833] (24 families) 
Family c.47.1.1: Thioltransferase [52834] (16 proteins) 
Protein Thioredoxin [52835] (16 species) 
Species Spinach (Spinacia oleracea), thioredoxin M [TaxId:3562] [52841] (3 PDB entries) 
Domain d1fb0a_: 1fb0 A: [32741]
Details for d1fb0a_
PDB Entry: 1fb0 (more details), 2.26 Å
PDB Description: crystal structure of thioredoxin m from spinach chloroplast (reduced form)
PDB Compounds: (A:) thioredoxin mSCOPe Domain Sequences for d1fb0a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1fb0a_ c.47.1.1 (A:) Thioredoxin {Spinach (Spinacia oleracea), thioredoxin M [TaxId: 3562]}
evqdvndsswkefvlesevpvmvdfwapwcgpckliapvidelakeysgkiavyklntde
apgiatqynirsiptvlffkngerkesiigavpkstltdsiekyl
SCOPe Domain Coordinates for d1fb0a_:
Click to download the PDB-style file with coordinates for d1fb0a_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1fb0a_:
- d1fb0a_ first appeared (with stable ids) in SCOP 1.55
- d1fb0a_ appears in SCOPe 2.07
View in 3D
