Lineage for d1faxa_ (1fax A:)
- Root: SCOPe 2.04
Class b: All beta proteins [48724] (176 folds) 
Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily)
barrel, closed; n=6, S=8; greek-key
duplication: consists of two domains of the same foldSuperfamily b.47.1: Trypsin-like serine proteases [50494] (5 families) 
Family b.47.1.2: Eukaryotic proteases [50514] (48 proteins) 
Protein Coagulation factor Xa, protease domain [50574] (2 species) Species Human (Homo sapiens) [TaxId:9606] [50575] (47 PDB entries)
Uniprot P00742 235-467
Domain d1faxa_: 1fax A: [26345]
Other proteins in same PDB: d1faxl_
complexed with ca, dx9
Details for d1faxa_
PDB Entry: 1fax (more details), 3 Å
PDB Description: coagulation factor xa inhibitor complex
PDB Compounds: (A:) factor xaSCOPe Domain Sequences for d1faxa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1faxa_ b.47.1.2 (A:) Coagulation factor Xa, protease domain {Human (Homo sapiens) [TaxId: 9606]}
ivggqeckdgecpwqallineenegfcggtilsefyiltaahclyqakrfkvrvgdrnta
aeeggeavhevevvikhnrftketydfdiavlrlktpitfrmnvapaclperdwaestlm
tqktgivsgfgrthekgrqstrlkmlevpyvdrnscklsssfiitqnmfcagydtkqeda
cqgdsggphvtrfkdtyfvtgivswgegcarkgkygiytkvtaflkwidrsmktr
SCOPe Domain Coordinates for d1faxa_:
Click to download the PDB-style file with coordinates for d1faxa_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1faxa_:
- d1faxa_ first appeared (with stable ids) in SCOP 1.55
- d1faxa_ appears in SCOPe 2.03
- d1faxa_ appears in SCOPe 2.05
- d1faxa_ appears in the current release, SCOPe 2.08
View in 3D
