Lineage for d1f9ca1 (1f9c A:131-372)
- Root: SCOPe 2.08
Class c: Alpha and beta proteins (a/b) [51349] (148 folds) 
Fold c.1: TIM beta/alpha-barrel [51350] (34 superfamilies)
contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
the first seven superfamilies have similar phosphate-binding sites
Superfamily c.1.11: Enolase C-terminal domain-like [51604] (3 families) 
binds metal ion (magnesium or manganese) in conserved site inside barrel
N-terminal alpha+beta domain is common to this superfamily
Family c.1.11.2: D-glucarate dehydratase-like [51609] (15 proteins) 
Protein Muconate-lactonizing enzyme [51615] (1 species) Species Pseudomonas putida [TaxId:303] [51616] (5 PDB entries) 
Domain d1f9ca1: 1f9c A:131-372 [59728]
Other proteins in same PDB: d1f9ca2, d1f9cb2
complexed with mn
Details for d1f9ca1
PDB Entry: 1f9c (more details), 2.5 Å
PDB Description: crystal structure of mle d178n variant
PDB Compounds: (A:) protein (muconate cycloisomerase I)SCOPe Domain Sequences for d1f9ca1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1f9ca1 c.1.11.2 (A:131-372) Muconate-lactonizing enzyme {Pseudomonas putida [TaxId: 303]}
rvrdslevawtlasgdtardiaearhmleirrhrvfklkiganpveqnlkhvvtikrelg
dsasvrvdvnqywdesqairacqvlgdngidlieqpisrinrggqvrlnqrtpapimade
siesvedafslaadgaasifalkiaknggpravlrtaqiaeaagiglyggtmlegsigtl
asahafltlrqltwgtelfgplllteeivneppqyrdfqlhiprtpglgltldearlarf
ar
SCOPe Domain Coordinates for d1f9ca1:
Click to download the PDB-style file with coordinates for d1f9ca1.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1f9ca1:
- d1f9ca1 first appeared in SCOP 1.57
- d1f9ca1 appears in SCOPe 2.07
View in 3D
