Lineage for d1f77a2 (1f77 A:102-214)
- Root: SCOPe 2.03
Class d: Alpha and beta proteins (a+b) [53931] (376 folds) 
Fold d.15: beta-Grasp (ubiquitin-like) [54235] (14 superfamilies)
core: beta(2)-alpha-beta(2); mixed beta-sheet 2143
Superfamily d.15.6: Superantigen toxins, C-terminal domain [54334] (2 families) 
Family d.15.6.1: Superantigen toxins, C-terminal domain [54335] (16 proteins) 
Protein Staphylococcal enterotoxin H, SEH [54346] (1 species) Species Staphylococcus aureus [TaxId:1280] [54347] (5 PDB entries) 
Domain d1f77a2: 1f77 A:102-214 [37789]
Other proteins in same PDB: d1f77a1, d1f77b1
complexed with so4
Details for d1f77a2
PDB Entry: 1f77 (more details), 2.4 Å
PDB Description: staphylococcal enterotoxin h determined to 2.4 a resolution
PDB Compounds: (A:) enterotoxin hSCOPe Domain Sequences for d1f77a2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1f77a2 d.15.6.1 (A:102-214) Staphylococcal enterotoxin H, SEH {Staphylococcus aureus [TaxId: 1280]}
eklaqerviganvwvdgiqketelirtnkknvtlqeldikirkilsdkykiyykdseisk
gliefdmktprdysfdiydlkgendyeidkiyednktlksddishidvnlytk
SCOPe Domain Coordinates for d1f77a2:
Click to download the PDB-style file with coordinates for d1f77a2.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1f77a2:
- d1f77a2 first appeared (with stable ids) in SCOP 1.55
- d1f77a2 appears in SCOPe 2.02
- d1f77a2 appears in SCOPe 2.04
- d1f77a2 appears in the current release, SCOPe 2.08
View in 3D
