Lineage for d1f5na1 (1f5n A:284-583)
- Root: SCOPe 2.05
Class a: All alpha proteins [46456] (286 folds) 
Fold a.114: Interferon-induced guanylate-binding protein 1 (GBP1), C-terminal domain [48339] (1 superfamily)
multihelical; bundle of longer and shorter helicesSuperfamily a.114.1: Interferon-induced guanylate-binding protein 1 (GBP1), C-terminal domain [48340] (2 families) 
automatically mapped to Pfam PF02841Family a.114.1.1: Interferon-induced guanylate-binding protein 1 (GBP1), C-terminal domain [48341] (1 protein) Protein Interferon-induced guanylate-binding protein 1 (GBP1), C-terminal domain [48342] (1 species) Species Human (Homo sapiens) [TaxId:9606] [48343] (2 PDB entries) 
Domain d1f5na1: 1f5n A:284-583 [19077]
Other proteins in same PDB: d1f5na2
complexed with gnp, mg
Details for d1f5na1
PDB Entry: 1f5n (more details), 1.7 Å
PDB Description: human guanylate binding protein-1 in complex with the gtp analogue, gmppnp.
PDB Compounds: (A:) interferon-induced guanylate-binding protein 1SCOPe Domain Sequences for d1f5na1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1f5na1 a.114.1.1 (A:284-583) Interferon-induced guanylate-binding protein 1 (GBP1), C-terminal domain {Human (Homo sapiens) [TaxId: 9606]}
ggiqvngprleslvltyvnaissgdlpcmenavlalaqiensaavqkaiahyeqqmgqkv
qlpteslqelldlhrdsereaievfirssfkdvdhlfqkelaaqlekkrddfckqnqeas
sdrcsgllqvifspleeevkagiyskpggyrlfvqklqdlkkkyyeeprkgiqaeeilqt
ylkskesmtdailqtdqtltekekeievervkaesaqasakmlhemqrkneqmmeqkers
yqehlkqltekmendrvqllkeqertlalklqeqeqllkegfqkesrimkneiqdlqtkm
SCOPe Domain Coordinates for d1f5na1:
Click to download the PDB-style file with coordinates for d1f5na1.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1f5na1:
- d1f5na1 first appeared (with stable ids) in SCOP 1.55
- d1f5na1 appears in SCOPe 2.04
- d1f5na1 appears in SCOPe 2.06
- d1f5na1 appears in the current release, SCOPe 2.08
View in 3D
