Lineage for d1f3rb1 (1f3r B:1-123)
- Root: SCOPe 2.04
Class b: All beta proteins [48724] (176 folds) 
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies)
sandwich; 7 strands in 2 sheets; greek-key
some members of the fold have additional strands
Superfamily b.1.1: Immunoglobulin [48726] (5 families) 
Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins) 
Protein Immunoglobulin heavy chain variable domain, VH [88543] (21 species)
VH domains of human and mouse antibodies are clustered by the sequence similarity within the germline encoded segment and then by the size of the complementarity determining regions CDR1 and CDR2, so the clusters may correspond to putative germline families in the species genomes; VH domains with artificial or grafted exogenous CDRs are listed as engineered species
Species Norway rat (Rattus norvegicus) [TaxId:10116] [88560] (16 PDB entries) 
Domain d1f3rb1: 1f3r B:1-123 [20416]
Other proteins in same PDB: d1f3rb2
part of scFv MAB198 against the main immunogenic region of the human muscle acetylcholine receptor; order: VH-linker-VL
Details for d1f3rb1
PDB Entry: 1f3r (more details)
PDB Description: complex between fv antibody fragment and an analogue of the main immunogenic region of the acetylcholine receptor
PDB Compounds: (B:) fv antibody fragmentSCOPe Domain Sequences for d1f3rb1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1f3rb1 b.1.1.1 (B:1-123) Immunoglobulin heavy chain variable domain, VH {Norway rat (Rattus norvegicus) [TaxId: 10116]}
qvqllesgpglvrpsetlsltctvsgfsltsfsvswvrhpsgkgpewmgrmwydgytayn
salksrlsisrdtsknqvflkmnslqtddtgtyyctrdlyggyplgfwyfdfwgpgtmvt
vss
SCOPe Domain Coordinates for d1f3rb1:
Click to download the PDB-style file with coordinates for d1f3rb1.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1f3rb1:
- d1f3rb1 first appeared (with stable ids) in SCOP 1.55
- d1f3rb1 appears in SCOPe 2.03
- d1f3rb1 appears in SCOPe 2.05
- d1f3rb1 appears in the current release, SCOPe 2.08
View in 3D
