Lineage for d1f3la_ (1f3l A:)

  1. Root: SCOPe 2.04
  2. 1565955Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1611695Fold c.66: S-adenosyl-L-methionine-dependent methyltransferases [53334] (1 superfamily)
    core: 3 layers, a/b/a; mixed beta-sheet of 7 strands, order 3214576; strand 7 is antiparallel to the rest
  4. 1611696Superfamily c.66.1: S-adenosyl-L-methionine-dependent methyltransferases [53335] (58 families) (S)
  5. 1611846Family c.66.1.6: Arginine methyltransferase [53351] (4 proteins)
    lacks the last two strands of the common fold replaced with a beta-sandwich oligomerisation subdomain
  6. 1611847Protein Arginine methyltransferase, HMT1 [53352] (2 species)
  7. 1611855Species Norway rat (Rattus norvegicus) [TaxId:10116] [64116] (1 PDB entry)
  8. 1611856Domain d1f3la_: 1f3l A: [59630]
    complexed with sah

Details for d1f3la_

PDB Entry: 1f3l (more details), 2.03 Å

PDB Description: crystal structure of the conserved core of protein arginine methyltransferase prmt3
PDB Compounds: (A:) protein arginine methyltransferase prmt3

SCOPe Domain Sequences for d1f3la_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1f3la_ c.66.1.6 (A:) Arginine methyltransferase, HMT1 {Norway rat (Rattus norvegicus) [TaxId: 10116]}
dlqededgvyfssyghygiheemlkdkvrtesyrdfiyqnphifkdkvvldvgcgtgils
mfaakagakkviavdqseilyqamdiirlnkledtivlikgkieevslpvekvdviisew
mgyfllfesmldsvlyakskylakggsvypdictislvavsdvskhadriafwddvygfn
mscmkkavipeavvevvdhktlisdpcdikhidchttsisdlefssdftlrttktamcta
vagyfdiyfeknchnrvvfstgpqstkthwkqtifllekpfpvkagealkgkitvhknkk
dprslivtltlnsstqtyslq

SCOPe Domain Coordinates for d1f3la_:

Click to download the PDB-style file with coordinates for d1f3la_.
(The format of our PDB-style files is described here.)

Timeline for d1f3la_: