Lineage for d1f0la1 (1f0l A:381-535)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2767182Fold b.2: Common fold of diphtheria toxin/transcription factors/cytochrome f [49379] (9 superfamilies)
    sandwich; 9 strands in 2 sheet; greek-key; subclass of immunoglobin-like fold
  4. 2767183Superfamily b.2.1: Diphtheria toxin, C-terminal domain [49380] (2 families) (S)
    automatically mapped to Pfam PF01324
  5. 2767184Family b.2.1.1: Diphtheria toxin, C-terminal domain [49381] (1 protein)
  6. 2767185Protein Diphtheria toxin, C-terminal domain [49382] (1 species)
  7. 2767186Species Corynebacterium diphtheriae [TaxId:1717] [49383] (7 PDB entries)
  8. 2767187Domain d1f0la1: 1f0l A:381-535 [22377]
    Other proteins in same PDB: d1f0la2, d1f0la3, d1f0lb2, d1f0lb3
    complexed with apu, cl

Details for d1f0la1

PDB Entry: 1f0l (more details), 1.55 Å

PDB Description: 1.55 angstrom crystal structure of wild type diphtheria toxin
PDB Compounds: (A:) diphtheria toxin

SCOPe Domain Sequences for d1f0la1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1f0la1 b.2.1.1 (A:381-535) Diphtheria toxin, C-terminal domain {Corynebacterium diphtheriae [TaxId: 1717]}
spghktqpflhdgyavswntvedsiirtgfqgesghdikitaentplpiagvllptipgk
ldvnkskthisvngrkirmrcraidgdvtfcrpkspvyvgngvhanlhvafhrsssekih
sneissdsigvlgyqktvdhtkvnsklslffeiks

SCOPe Domain Coordinates for d1f0la1:

Click to download the PDB-style file with coordinates for d1f0la1.
(The format of our PDB-style files is described here.)

Timeline for d1f0la1: