SCOP 1.75: Domain d1ezvb1: 1ezv B:17-218

Lineage for d1ezvb1 (1ezv B:17-218)

Root: SCOP 1.75
Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
Fold d.185: LuxS/MPP-like metallohydrolase [63410] (1 superfamily)
core: beta-alpha-beta(2)-alpha(2); 2 layers: alpha/beta
Superfamily d.185.1: LuxS/MPP-like metallohydrolase [63411] (2 families)
Share the same "active site motif" HxxEH located in the first core helix, but differ in one of the zinc-binding residues

Family d.185.1.1: MPP-like [63412] (6 proteins)
Common fold elaborated with many additional structures; duplication: each family member consists of two similar domains of beta(2)-alpha(2)-beta(2)-alpha(5)-beta structure, but only the N-terminal domain of MPP beta chain binds the catalytic metal

Protein Cytochrome bc1 core subunit 2 [63409] (3 species)
Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [64305] (7 PDB entries)
Domain d1ezvb1: 1ezv B:17-218 [59543]
Other proteins in same PDB: d1ezva1, d1ezva2, d1ezvc2, d1ezvc3, d1ezvd1, d1ezvd2, d1ezve1, d1ezve2, d1ezvf_, d1ezvg_, d1ezvh_, d1ezvi_, d1ezvx_, d1ezvy_

Details for d1ezvb1

PDB Entry: 1ezv (more details), 2.3 Å

PDB Description: structure of the yeast cytochrome bc1 complex co-crystallized with an antibody fv-fragment

PDB Compounds: (B:) ubiquinol-cytochrome c reductase complex core protein 2

SCOP Domain Sequences for d1ezvb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ezvb1 d.185.1.1 (B:17-218) Cytochrome bc1 core subunit 2 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
ltvsardaptkistlavkvhggsryatkdgvahllnrfnfqntntrsalklvresellgg
tfkstldreyitlkatflkddlpyyvnaladvlyktafkpheltesvlpaarydyavaeq
cpvksaedqlyaitfrkglgnpllydgvervslqdikdfadkvytkenlevsgenvvead
lkrfvdesllstlpagkslvsk

SCOP Domain Coordinates for d1ezvb1:

Click to download the PDB-style file with coordinates for d1ezvb1.
(The format of our PDB-style files is described here.)

Timeline for d1ezvb1: