Lineage for d1exua2 (1exu A:4-176)
- Root: SCOPe 2.05
Class d: Alpha and beta proteins (a+b) [53931] (381 folds) 
Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily)
dimericSuperfamily d.19.1: MHC antigen-recognition domain [54452] (2 families) 
Family d.19.1.1: MHC antigen-recognition domain [54453] (13 proteins) 
Protein Fc (IgG) receptor, alpha-1 and alpha-2 domains [54454] (2 species)
class I MHC-related
Species Human (Homo sapiens) [TaxId:9606] [54493] (1 PDB entry) 
Domain d1exua2: 1exu A:4-176 [38324]
Other proteins in same PDB: d1exua1, d1exub_
complexed with bme
Details for d1exua2
PDB Entry: 1exu (more details), 2.7 Å
PDB Description: crystal structure of the human mhc-related fc receptor
PDB Compounds: (A:) igg receptor fcrn large subunit p51SCOPe Domain Sequences for d1exua2:
Sequence, based on SEQRES records: (download)
>d1exua2 d.19.1.1 (A:4-176) Fc (IgG) receptor, alpha-1 and alpha-2 domains {Human (Homo sapiens) [TaxId: 9606]}
hlsllyhltavsspapgtpafwvsgwlgpqqylsynslrgeaepcgawvwenqvswywek
ettdlrikeklfleafkalggkgpytlqgllgcelgpdntsvptakfalngeefmnfdlk
qgtwggdwpealaisqrwqqqdkaankeltfllfscphrlrehlergrgnlew
Sequence, based on observed residues (ATOM records): (download)
>d1exua2 d.19.1.1 (A:4-176) Fc (IgG) receptor, alpha-1 and alpha-2 domains {Human (Homo sapiens) [TaxId: 9606]}
hlsllyhltavsspapgtpafwvsgwlgpqqylsynslrgeaepcgawywekettdlrik
eklfleafkalggkgpytlqgllgcelgpdntsvptakfalngeefmnfdlkqgtwggdw
pealaisqrwqqqdkaankeltfllfscphrlrehlergrgnlew
SCOPe Domain Coordinates for d1exua2:
Click to download the PDB-style file with coordinates for d1exua2.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1exua2:
- d1exua2 first appeared (with stable ids) in SCOP 1.55
- d1exua2 appears in SCOPe 2.04
- d1exua2 appears in SCOPe 2.06
- d1exua2 appears in the current release, SCOPe 2.08
View in 3D
