Lineage for d1exua1 (1exu A:177-267)

  1. Root: SCOPe 2.06
  2. 2021373Class b: All beta proteins [48724] (177 folds)
  3. 2021374Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2021375Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2025133Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)
  6. 2026937Protein Fc (IgG) receptor, alpha-3 domain [88612] (2 species)
  7. 2026938Species Human (Homo sapiens) [TaxId:9606] [88614] (1 PDB entry)
  8. 2026939Domain d1exua1: 1exu A:177-267 [20864]
    Other proteins in same PDB: d1exua2, d1exub_
    complexed with bme

Details for d1exua1

PDB Entry: 1exu (more details), 2.7 Å

PDB Description: crystal structure of the human mhc-related fc receptor
PDB Compounds: (A:) igg receptor fcrn large subunit p51

SCOPe Domain Sequences for d1exua1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1exua1 b.1.1.2 (A:177-267) Fc (IgG) receptor, alpha-3 domain {Human (Homo sapiens) [TaxId: 9606]}
keppsmrlkarpsspgfsvltcsafsfyppelqlrflrnglaagtgqgdfgpnsdgsfha
sssltvksgdehhyccivqhaglaqplrvel

SCOPe Domain Coordinates for d1exua1:

Click to download the PDB-style file with coordinates for d1exua1.
(The format of our PDB-style files is described here.)

Timeline for d1exua1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1exua2
View in 3D
Domains from other chains:
(mouse over for more information)
d1exub_