Lineage for d1euma_ (1eum A:)

  1. Root: SCOPe 2.04
  2. 1473060Class a: All alpha proteins [46456] (285 folds)
  3. 1484437Fold a.25: Ferritin-like [47239] (6 superfamilies)
    core: 4 helices; bundle, closed, left-handed twist; 1 crossover connection
  4. 1484438Superfamily a.25.1: Ferritin-like [47240] (10 families) (S)
    contains bimetal-ion centre in the middle of the bundle
  5. 1484439Family a.25.1.1: Ferritin [47241] (10 proteins)
  6. 1485212Protein Non-hem ferritin [63524] (6 species)
  7. 1485219Species Escherichia coli, FtnA [TaxId:562] [63525] (1 PDB entry)
  8. 1485220Domain d1euma_: 1eum A: [59507]

Details for d1euma_

PDB Entry: 1eum (more details), 2.05 Å

PDB Description: crystal structure of the e.coli ferritin ecftna
PDB Compounds: (A:) ferritin 1

SCOPe Domain Sequences for d1euma_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1euma_ a.25.1.1 (A:) Non-hem ferritin {Escherichia coli, FtnA [TaxId: 562]}
lkpemieklneqmnlelyssllyqqmsawcsyhtfegaaaflrrhaqeemthmqrlfdyl
tdtgnlprintvespfaeyssldelfqetykheqlitqkinelahaamtnqdyptfnflq
wyvseqheeeklfksiidklslagksgeglyfidkelstld

SCOPe Domain Coordinates for d1euma_:

Click to download the PDB-style file with coordinates for d1euma_.
(The format of our PDB-style files is described here.)

Timeline for d1euma_: