Lineage for d1euda2 (1eud A:131-306)

  1. Root: SCOPe 2.03
  2. 1336837Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 1356042Fold c.23: Flavodoxin-like [52171] (15 superfamilies)
    3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345
  4. 1356635Superfamily c.23.4: Succinyl-CoA synthetase domains [52210] (2 families) (S)
  5. 1356636Family c.23.4.1: Succinyl-CoA synthetase domains [52211] (3 proteins)
    contain additional N-terminal strand "0", antiparallel to strand 2
  6. 1356643Protein Succinyl-CoA synthetase, alpha-chain, C-terminal domain [52212] (5 species)
  7. 1356673Species Pig (Sus scrofa) [TaxId:9823] [52214] (6 PDB entries)
  8. 1356674Domain d1euda2: 1eud A:131-306 [31140]
    Other proteins in same PDB: d1euda1, d1eudb1, d1eudb2
    complexed with so4

Details for d1euda2

PDB Entry: 1eud (more details), 2.1 Å

PDB Description: crystal structure of phosphorylated pig heart, gtp-specific succinyl- coa synthetase
PDB Compounds: (A:) succinyl-coa synthetase, alpha chain

SCOPe Domain Sequences for d1euda2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1euda2 c.23.4.1 (A:131-306) Succinyl-CoA synthetase, alpha-chain, C-terminal domain {Pig (Sus scrofa) [TaxId: 9823]}
ncpgvinpgeckigimpghihkkgrigivsrsgtltyeavhqttqvglgqslcvgiggdp
fngtdftdcleiflndpategiiligeiggnaeenaaeflkqhnsgpkskpvvsfiaglt
appgrrmghagaiiaggkggakekitalqsagvvvsmspaqlgttiykefekrkml

SCOPe Domain Coordinates for d1euda2:

Click to download the PDB-style file with coordinates for d1euda2.
(The format of our PDB-style files is described here.)

Timeline for d1euda2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1euda1