Lineage for d1euca1 (1euc A:1-130)
- Root: SCOPe 2.01
Class c: Alpha and beta proteins (a/b) [51349] (147 folds) 
Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
The nucleotide-binding modes of this and the next two folds/superfamilies are similarSuperfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) 
Family c.2.1.8: CoA-binding domain [51900] (6 proteins) Protein Succinyl-CoA synthetase, alpha-chain, N-terminal (CoA-binding) domain [51901] (3 species) 
Species Pig (Sus scrofa) [TaxId:9823] [51903] (6 PDB entries) 
Domain d1euca1: 1euc A:1-130 [30311]
Other proteins in same PDB: d1euca2, d1eucb1, d1eucb2
complexed with po4, so4, zn
Details for d1euca1
PDB Entry: 1euc (more details), 2.1 Å
PDB Description: crystal structure of dephosphorylated pig heart, gtp-specific succinyl-coa synthetase
PDB Compounds: (A:) succinyl-coa synthetase, alpha chainSCOPe Domain Sequences for d1euca1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1euca1 c.2.1.8 (A:1-130) Succinyl-CoA synthetase, alpha-chain, N-terminal (CoA-binding) domain {Pig (Sus scrofa) [TaxId: 9823]}
csytasrkhlyvdkntkvicqgftgkqgtfhsqqaleygtnlvggttpgkggkthlglpv
fntvkeakeqtgatasviyvpppfaaaaineaidaevplvvcitegipqqdmvrvkhrll
rqgktrligp
SCOPe Domain Coordinates for d1euca1:
Click to download the PDB-style file with coordinates for d1euca1.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1euca1:
- d1euca1 first appeared (with stable ids) in SCOP 1.55
- d1euca1 appears in SCOP 1.75
- d1euca1 appears in SCOPe 2.02
- d1euca1 appears in the current release, SCOPe 2.08
View in 3D
