SCOPe 2.04: Domain d1etza2: 1etz A:111-215

Lineage for d1etza2 (1etz A:111-215)

Root: SCOPe 2.04
Class b: All beta proteins [48724] (176 folds)
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies)
sandwich; 7 strands in 2 sheets; greek-key
some members of the fold have additional strands
Superfamily b.1.1: Immunoglobulin [48726] (5 families)
Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)
Protein Immunoglobulin light chain lambda constant domain, CL-lambda [88570] (3 species)
Species Mouse (Mus musculus) [TaxId:10090] [88571] (21 PDB entries)
Uniprot Q8N355 20-230 # 94% sequence identity; natural chimera: antibody light chain (Fab HYB3)
Domain d1etza2: 1etz A:111-215 [21444]
Other proteins in same PDB: d1etza1, d1etzb1, d1etzb2, d1etzh1, d1etzh2, d1etzl1
part of anti-sweetener Fab NC10.14
complexed with gas

Details for d1etza2

PDB Entry: 1etz (more details), 2.6 Å

PDB Description: the three-dimensional structure of an anti-sweetener fab, nc10.14, shows the extent of structural diversity in antigen recognition by immunoglobulins

PDB Compounds: (A:) fab nc10.14 - light chain

SCOPe Domain Sequences for d1etza2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1etza2 b.1.1.2 (A:111-215) Immunoglobulin light chain lambda constant domain, CL-lambda {Mouse (Mus musculus) [TaxId: 10090]}
qpksspsvtlftpsseeletnkatlvctitdfypgvvtvdwkvdgtpvtqgmettqpskq
snnkymassyltltarawerhssyscqvtheghtvekslsraecs

SCOPe Domain Coordinates for d1etza2:

Click to download the PDB-style file with coordinates for d1etza2.
(The format of our PDB-style files is described here.)

Timeline for d1etza2: