Lineage for d1eqzc_ (1eqz C:)

  1. Root: SCOP 1.73
  2. 631650Class a: All alpha proteins [46456] (258 folds)
  3. 637441Fold a.22: Histone-fold [47112] (1 superfamily)
    core: 3 helices; long middle helix is flanked at each end with shorter ones
  4. 637442Superfamily a.22.1: Histone-fold [47113] (4 families) (S)
  5. 637443Family a.22.1.1: Nucleosome core histones [47114] (5 proteins)
    form octamers composed of two copies of each of the four histones
  6. 637576Protein Histone H3 [47122] (4 species)
  7. 637627Species Chicken (Gallus gallus), erythrocytes [TaxId:9031] [47123] (7 PDB entries)
  8. 637634Domain d1eqzc_: 1eqz C: [16456]
    Other proteins in same PDB: d1eqza_, d1eqzb_, d1eqzd_, d1eqze_, d1eqzf_, d1eqzh_

Details for d1eqzc_

PDB Entry: 1eqz (more details), 2.5 Å

PDB Description: x-ray structure of the nucleosome core particle at 2.5 a resolution
PDB Compounds: (C:) protein (histone h3)

SCOP Domain Sequences for d1eqzc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1eqzc_ a.22.1.1 (C:) Histone H3 {Chicken (Gallus gallus), erythrocytes [TaxId: 9031]}
apatggvkkphryrpgtvalreirryqkstellirklpfqrlvreiaqdfktdlrfqssa
vmalqeaseaylvglfedtnlcaihakrvtimpkdiqlarrirgera

SCOP Domain Coordinates for d1eqzc_:

Click to download the PDB-style file with coordinates for d1eqzc_.
(The format of our PDB-style files is described here.)

Timeline for d1eqzc_: