Lineage for d1ep7a_ (1ep7 A:)
- Root: SCOPe 2.08
Class c: Alpha and beta proteins (a/b) [51349] (148 folds) 
Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the restSuperfamily c.47.1: Thioredoxin-like [52833] (24 families) 
Family c.47.1.1: Thioltransferase [52834] (16 proteins) 
Protein Thioredoxin [52835] (16 species) 
Species Green alga (Chlamydomonas reinhardtii) [TaxId:3055] [52838] (4 PDB entries) 
Domain d1ep7a_: 1ep7 A: [64905]
Details for d1ep7a_
PDB Entry: 1ep7 (more details), 2.1 Å
PDB Description: crystal structure of wt thioredoxin h from chlamydomonas reinhardtii
PDB Compounds: (A:) thioredoxin ch1, h-typeSCOPe Domain Sequences for d1ep7a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ep7a_ c.47.1.1 (A:) Thioredoxin {Green alga (Chlamydomonas reinhardtii) [TaxId: 3055]}
ggsvividskaawdaqlakgkeehkpivvdftatwcgpckmiaplfetlsndyagkvifl
kvdvdavaavaeaagitamptfhvykdgvkaddlvgasqdklkalvakhaaa
SCOPe Domain Coordinates for d1ep7a_:
Click to download the PDB-style file with coordinates for d1ep7a_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1ep7a_:
- d1ep7a_ first appeared in SCOP 1.59
- d1ep7a_ appears in SCOPe 2.07
View in 3D
