Class d: Alpha and beta proteins (a+b) [53931] (388 folds) |
Fold d.27: Ribosomal protein S16 [54564] (1 superfamily) beta(4)-alpha-beta; 2 layers: alpha/beta; mixed beta-sheet, order: 51234 |
Superfamily d.27.1: Ribosomal protein S16 [54565] (1 family) |
Family d.27.1.1: Ribosomal protein S16 [54566] (1 protein) |
Protein Ribosomal protein S16 [54567] (3 species) |
Species Thermus thermophilus [TaxId:274] [54568] (37 PDB entries) Uniprot P80379 |
Domain d1emwa_: 1emw A: [38448] |
PDB Entry: 1emw (more details)
SCOPe Domain Sequences for d1emwa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1emwa_ d.27.1.1 (A:) Ribosomal protein S16 {Thermus thermophilus [TaxId: 274]} mvkirlarfgskhnphyrivvtdarrkrdgkyiekigyydprkttpdwlkvdverarywl svgaqptdtarrllrqagvfrqearega
Timeline for d1emwa_: