Lineage for d1ejol1 (1ejo L:2001-2111)

  1. Root: SCOPe 2.03
  2. 1287432Class b: All beta proteins [48724] (174 folds)
  3. 1287433Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 1287434Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 1287435Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)
  6. 1288590Protein Immunoglobulin light chain kappa variable domain, VL-kappa [88519] (16 species)
    VL-kappa domains of human and mouse antibodies are clustered by the sequence similarity within the germline encoded segment and then by the size of the complementarity determining regions CDR1 and CDR2, so the clusters may correspond to putative germline families in the species genomes; VL-kappa domains with artificial or grafted exogenous CDRs are listed as engineered species
  7. 1289056Species Mouse (Mus musculus), cluster 2 [TaxId:10090] [88526] (30 PDB entries)
  8. 1289066Domain d1ejol1: 1ejo L:2001-2111 [20428]
    Other proteins in same PDB: d1ejoh1, d1ejoh2, d1ejol2
    part of anti-FMDV Fab 4C4

Details for d1ejol1

PDB Entry: 1ejo (more details), 2.3 Å

PDB Description: fab fragment of neutralising monoclonal antibody 4c4 complexed with g- h loop from fmdv.
PDB Compounds: (L:) igg2a monoclonal antibody (light chain)

SCOPe Domain Sequences for d1ejol1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ejol1 b.1.1.1 (L:2001-2111) Immunoglobulin light chain kappa variable domain, VL-kappa {Mouse (Mus musculus), cluster 2 [TaxId: 10090]}
divltqspaslavslgqratiscrasesvdsygnsfmhwyqqkpgqppklliyrasnles
giparfsgsgsrtdftltinpveaddvatyycqqsnedpltfgagtklelk

SCOPe Domain Coordinates for d1ejol1:

Click to download the PDB-style file with coordinates for d1ejol1.
(The format of our PDB-style files is described here.)

Timeline for d1ejol1:

1289066
d1ejol1 in context of chain
View in 3D
Domains from same chain:
(mouse over for more information)
d1ejol2