Class f: Membrane and cell surface proteins and peptides [56835] (58 folds) |
Fold f.17: Transmembrane helix hairpin [81334] (5 superfamilies) two antiparallel transmembrane helices |
Superfamily f.17.2: Cytochrome c oxidase subunit II-like, transmembrane region [81464] (1 family) |
Family f.17.2.1: Cytochrome c oxidase subunit II-like, transmembrane region [81463] (4 proteins) |
Protein Bacterial ba3 type cytochrome c oxidase subunit II [81460] (1 species) |
Species Thermus thermophilus [TaxId:274] [81459] (5 PDB entries) the "missing" first helix is complemented by the ba3 subunit IIa |
Domain d1ehkb2: 1ehk B:3-40 [43625] Other proteins in same PDB: d1ehka_, d1ehkb1, d1ehkc_ complexed with 1cu, bng, cua, has, hem |
PDB Entry: 1ehk (more details), 2.4 Å
SCOP Domain Sequences for d1ehkb2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ehkb2 f.17.2.1 (B:3-40) Bacterial ba3 type cytochrome c oxidase subunit II {Thermus thermophilus [TaxId: 274]} dehkahkailayekgwlafslamlfvfialiaytlath
Timeline for d1ehkb2: