Lineage for d1ehkb2 (1ehk B:3-40)
- Root: SCOP 1.75
Class f: Membrane and cell surface proteins and peptides [56835] (58 folds) 
Fold f.17: Transmembrane helix hairpin [81334] (5 superfamilies)
two antiparallel transmembrane helicesSuperfamily f.17.2: Cytochrome c oxidase subunit II-like, transmembrane region [81464] (1 family) 
Family f.17.2.1: Cytochrome c oxidase subunit II-like, transmembrane region [81463] (4 proteins) 
Protein Bacterial ba3 type cytochrome c oxidase subunit II [81460] (1 species) Species Thermus thermophilus [TaxId:274] [81459] (5 PDB entries)
the "missing" first helix is complemented by the ba3 subunit IIa
Domain d1ehkb2: 1ehk B:3-40 [43625]
Other proteins in same PDB: d1ehka_, d1ehkb1, d1ehkc_
complexed with 1cu, bng, cua, has, hem
Details for d1ehkb2
PDB Entry: 1ehk (more details), 2.4 Å
PDB Description: crystal structure of the aberrant ba3-cytochrome-c oxidase from thermus thermophilus
PDB Compounds: (B:) ba3-type cytochrome-c oxidaseSCOP Domain Sequences for d1ehkb2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ehkb2 f.17.2.1 (B:3-40) Bacterial ba3 type cytochrome c oxidase subunit II {Thermus thermophilus [TaxId: 274]}
dehkahkailayekgwlafslamlfvfialiaytlath
SCOP Domain Coordinates for d1ehkb2:
Click to download the PDB-style file with coordinates for d1ehkb2.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1ehkb2:
- d1ehkb2 first appeared (with stable ids) in SCOP 1.55
- d1ehkb2 appears in SCOP 1.73
- d1ehkb2 appears in SCOPe 2.01
- d1ehkb2 appears in the current release, SCOPe 2.08
View in 3D
