Lineage for d1ehib1 (1ehi B:402-534)

  1. Root: SCOPe 2.03
  2. 1336837Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 1360440Fold c.30: PreATP-grasp domain [52439] (1 superfamily)
    3 layers: a/b/a; parallel or mixed beta-sheet of 4 to 6 strands
    possible rudiment form of Rossmann-fold domain
  4. 1360441Superfamily c.30.1: PreATP-grasp domain [52440] (9 families) (S)
    precedes the ATP-grasp domain common to all superfamily members, can contain a substrate-binding function
  5. 1360610Family c.30.1.2: D-Alanine ligase N-terminal domain [52452] (2 proteins)
  6. 1360616Protein D-alanine:D-lactate ligase VanA, N-domain [52455] (2 species)
  7. 1360620Species Leuconostoc mesenteroides, Ddl2 [TaxId:1245] [52456] (1 PDB entry)
  8. 1360622Domain d1ehib1: 1ehi B:402-534 [31717]
    Other proteins in same PDB: d1ehia2, d1ehib2
    complexed with adp, mg, phy

Details for d1ehib1

PDB Entry: 1ehi (more details), 2.38 Å

PDB Description: d-alanine:d-lactate ligase (lmddl2) of vancomycin-resistant leuconostoc mesenteroides
PDB Compounds: (B:) d-alanine:d-lactate ligase

SCOPe Domain Sequences for d1ehib1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ehib1 c.30.1.2 (B:402-534) D-alanine:D-lactate ligase VanA, N-domain {Leuconostoc mesenteroides, Ddl2 [TaxId: 1245]}
tkkrvalifggnssehdvskrsaqnfynaieatgkyeiivfaiaqngffldtesskkila
ledeqpivdafmktvdasdplarihalksagdfdiffpvvhgnlgedgtlqglfklldkp
yvgaplrghavsf

SCOPe Domain Coordinates for d1ehib1:

Click to download the PDB-style file with coordinates for d1ehib1.
(The format of our PDB-style files is described here.)

Timeline for d1ehib1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1ehib2