![]() | Class d: Alpha and beta proteins (a+b) [53931] (376 folds) |
![]() | Fold d.67: RRF/tRNA synthetase additional domain-like [55185] (4 superfamilies) core: alpha-beta(2)-alpha-beta(2); 2 layers: alpha/beta |
![]() | Superfamily d.67.3: Ribosome recycling factor, RRF [55194] (1 family) ![]() |
![]() | Family d.67.3.1: Ribosome recycling factor, RRF [55195] (1 protein) |
![]() | Protein Ribosome recycling factor, RRF [55196] (7 species) |
![]() | Species Thermus thermophilus [TaxId:274] [55198] (9 PDB entries) |
![]() | Domain d1eh1a_: 1eh1 A: [39565] |
PDB Entry: 1eh1 (more details), 2.6 Å
SCOP Domain Sequences for d1eh1a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1eh1a_ d.67.3.1 (A:) Ribosome recycling factor, RRF {Thermus thermophilus [TaxId: 274]} mtlkelyaetrshmqkslevlehnlaglrtgranpalllhlkveyygahvplnqiatvta pdprtlvvqswdqnalkaiekairdsdlglnpsnkgdalyinipplteerrkdlvravrq yaeegrvairnirrealdklkklakelhlsedetkraeaeiqkitdefiakadqlaekke qeilg
Timeline for d1eh1a_: