Lineage for d1egaa1 (1ega A:4-182)
- Root: SCOPe 2.02
Class c: Alpha and beta proteins (a/b) [51349] (147 folds) 
Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
3 layers: a/b/a, parallel or mixed beta-sheets of variable sizesSuperfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (25 families) 
division into families based on beta-sheet topologies
Family c.37.1.8: G proteins [52592] (79 proteins)
core: mixed beta-sheet of 6 strands, order 231456; strand 2 is antiparallel to the rest
Protein GTPase Era, N-terminal domain [52637] (2 species) 
Species Escherichia coli [TaxId:562] [52638] (2 PDB entries) 
Domain d1egaa1: 1ega A:4-182 [32150]
Other proteins in same PDB: d1egaa2, d1egab2
complexed with so4
Details for d1egaa1
PDB Entry: 1ega (more details), 2.4 Å
PDB Description: crystal structure of a widely conserved gtpase era
PDB Compounds: (A:) protein (GTP-binding protein era)SCOPe Domain Sequences for d1egaa1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1egaa1 c.37.1.8 (A:4-182) GTPase Era, N-terminal domain {Escherichia coli [TaxId: 562]}
dksycgfiaivgrpnvgkstllnkllgqkisitsrkaqttrhrivgihtegayqaiyvdt
pglhmeekrainrlmnkaasssigdvelvifvvegtrwtpddemvlnklregkapvilav
nkvdnvqekadllphlqflasqmnfldivpisaetglnvdtiaaivrkhlpeathhfpe
SCOPe Domain Coordinates for d1egaa1:
Click to download the PDB-style file with coordinates for d1egaa1.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1egaa1:
- d1egaa1 first appeared (with stable ids) in SCOP 1.55
- d1egaa1 appears in SCOPe 2.01
- d1egaa1 appears in SCOPe 2.03
- d1egaa1 appears in the current release, SCOPe 2.08
View in 3D
