Lineage for d1eg0k_ (1eg0 K:)

  1. Root: SCOP 1.75
  2. 896322Class i: Low resolution protein structures [58117] (26 folds)
  3. 896323Fold i.1: Ribosome and ribosomal fragments [58118] (1 superfamily)
  4. 896324Superfamily i.1.1: Ribosome and ribosomal fragments [58119] (3 families) (S)
  5. 896325Family i.1.1.1: Ribosome complexes [58120] (1 protein)
  6. 896326Protein 70S ribosome functional complex [58121] (9 species)
  7. 896398Species Escherichia coli [TaxId:562] [58123] (72 PDB entries)
  8. 896468Domain d1eg0k_: 1eg0 K: [45817]

Details for d1eg0k_

PDB Entry: 1eg0 (more details), 11.5 Å

PDB Description: fitting of components with known structure into an 11.5 a cryo-em map of the e.coli 70s ribosome
PDB Compounds: (K:) protein (ribosomal protein l11)

SCOP Domain Sequences for d1eg0k_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1eg0k_ i.1.1.1 (K:) 70S ribosome functional complex {Escherichia coli [TaxId: 562]}
qiklqlpagkatpappvgpalgqhgvnimefckrfnaetadkagmilpvvitvyedksft
fiiktppasfllkkaagiekgssepkrkivgkvtrkqieeiaktkmpdlnansleaamki
iegtaksmgievv

SCOP Domain Coordinates for d1eg0k_:

Click to download the PDB-style file with coordinates for d1eg0k_.
(The format of our PDB-style files is described here.)

Timeline for d1eg0k_: