Lineage for d1eema1 (1eem A:103-241)
- Root: SCOPe 2.04
Class a: All alpha proteins [46456] (285 folds) 
Fold a.45: GST C-terminal domain-like [47615] (1 superfamily)
core: 4 helices; bundle, closed, left-handed twist; right-handed superhelixSuperfamily a.45.1: GST C-terminal domain-like [47616] (3 families) 
this domains follows the thioredoxin-like N-terminal domain
Family a.45.1.1: Glutathione S-transferase (GST), C-terminal domain [47617] (19 proteins) 
Protein Class omega GST [81352] (1 species) Species Human (Homo sapiens) [TaxId:9606] [47632] (1 PDB entry) 
Domain d1eema1: 1eem A:103-241 [17717]
Other proteins in same PDB: d1eema2
complexed with gsh, so4
Details for d1eema1
PDB Entry: 1eem (more details), 2 Å
PDB Description: glutathione transferase from homo sapiens
PDB Compounds: (A:) glutathione-s-transferaseSCOPe Domain Sequences for d1eema1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1eema1 a.45.1.1 (A:103-241) Class omega GST {Human (Homo sapiens) [TaxId: 9606]}
lpddpyekacqkmilelfskvpslvgsfirsqnkedyaglkeefrkeftkleevltnkkt
tffggnsismidyliwpwferleamklnecvdhtpklklwmaamkedptvsalltsekdw
qgflelylqnspeacdygl
SCOPe Domain Coordinates for d1eema1:
Click to download the PDB-style file with coordinates for d1eema1.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1eema1:
- d1eema1 first appeared (with stable ids) in SCOP 1.55
- d1eema1 appears in SCOPe 2.03
- d1eema1 appears in SCOPe 2.05
- d1eema1 appears in the current release, SCOPe 2.08
View in 3D
