Lineage for d1eb7a2 (1eb7 A:165-323)

  1. Root: SCOPe 2.05
  2. 1715731Class a: All alpha proteins [46456] (286 folds)
  3. 1719636Fold a.3: Cytochrome c [46625] (1 superfamily)
    core: 3 helices; folded leaf, opened
  4. 1719637Superfamily a.3.1: Cytochrome c [46626] (9 families) (S)
    covalently-bound heme completes the core
  5. 1720225Family a.3.1.5: Di-heme cytochrome c peroxidase [46685] (1 protein)
    duplication: contains two cytochrome c-type domains
  6. 1720226Protein Di-heme cytochrome c peroxidase [46686] (3 species)
  7. 1720236Species Pseudomonas aeruginosa [TaxId:287] [46687] (2 PDB entries)
  8. 1720242Domain d1eb7a2: 1eb7 A:165-323 [59405]
    complexed with ca, hec

Details for d1eb7a2

PDB Entry: 1eb7 (more details), 2.4 Å

PDB Description: crystal structure of the di-haem cytochrome c peroxidase from pseudomonas aeruginosa
PDB Compounds: (A:) cytochrome c551 peroxidase

SCOPe Domain Sequences for d1eb7a2:

Sequence, based on SEQRES records: (download)

>d1eb7a2 a.3.1.5 (A:165-323) Di-heme cytochrome c peroxidase {Pseudomonas aeruginosa [TaxId: 287]}
tpdspfdlylkgddkaldaqqkkglkafmdsgcsachnginlggqayfpfglvkkpdasv
lpsgdkgrfavtktqsdeyvfraaplrnvaltapyfhsgqvwelkdavaimgnaqlgkql
apddvenivaflhslsgkqprveypllpastettprpae

Sequence, based on observed residues (ATOM records): (download)

>d1eb7a2 a.3.1.5 (A:165-323) Di-heme cytochrome c peroxidase {Pseudomonas aeruginosa [TaxId: 287]}
tpdspfdlylkgddkaldaqqkkglkafmdsgcsachnginlggqayfpfglvkkpdadk
grfavtktqsdeyvfraaplrnvaltapyfhsgqvwelkdavaimgnaqlgkqlapddve
nivaflhslsgkqprveypllpastettprpae

SCOPe Domain Coordinates for d1eb7a2:

Click to download the PDB-style file with coordinates for d1eb7a2.
(The format of our PDB-style files is described here.)

Timeline for d1eb7a2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1eb7a1