Lineage for d1eb7a1 (1eb7 A:1-164)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 1980705Fold a.3: Cytochrome c [46625] (1 superfamily)
    core: 3 helices; folded leaf, opened
  4. 1980706Superfamily a.3.1: Cytochrome c [46626] (9 families) (S)
    covalently-bound heme completes the core
  5. 1981360Family a.3.1.5: Di-heme cytochrome c peroxidase [46685] (1 protein)
    duplication: contains two cytochrome c-type domains
  6. 1981361Protein Di-heme cytochrome c peroxidase [46686] (3 species)
  7. 1981371Species Pseudomonas aeruginosa [TaxId:287] [46687] (2 PDB entries)
  8. 1981376Domain d1eb7a1: 1eb7 A:1-164 [59404]
    complexed with ca, hec

Details for d1eb7a1

PDB Entry: 1eb7 (more details), 2.4 Å

PDB Description: crystal structure of the di-haem cytochrome c peroxidase from pseudomonas aeruginosa
PDB Compounds: (A:) cytochrome c551 peroxidase

SCOPe Domain Sequences for d1eb7a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1eb7a1 a.3.1.5 (A:1-164) Di-heme cytochrome c peroxidase {Pseudomonas aeruginosa [TaxId: 287]}
dalhdqasalfkpipeqvtelrgqpiseqqrelgkklffdprlsrshvlscntchnvgtg
gadnvptsvghgwqkgprnsptvfnavfnaaqfwdgrakdlgeqakgpiqnsvemhstpq
lveqtlgsipeyvdafrkafpkagkpvsfdnmalaieayeatlv

SCOPe Domain Coordinates for d1eb7a1:

Click to download the PDB-style file with coordinates for d1eb7a1.
(The format of our PDB-style files is described here.)

Timeline for d1eb7a1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1eb7a2