| Class a: All alpha proteins [46456] (286 folds) |
| Fold a.3: Cytochrome c [46625] (1 superfamily) core: 3 helices; folded leaf, opened |
Superfamily a.3.1: Cytochrome c [46626] (9 families) ![]() covalently-bound heme completes the core |
| Family a.3.1.5: Di-heme cytochrome c peroxidase [46685] (1 protein) duplication: contains two cytochrome c-type domains |
| Protein Di-heme cytochrome c peroxidase [46686] (3 species) |
| Species Pseudomonas aeruginosa [TaxId:287] [46687] (2 PDB entries) |
| Domain d1eb7a1: 1eb7 A:1-164 [59404] complexed with ca, hec |
PDB Entry: 1eb7 (more details), 2.4 Å
SCOPe Domain Sequences for d1eb7a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1eb7a1 a.3.1.5 (A:1-164) Di-heme cytochrome c peroxidase {Pseudomonas aeruginosa [TaxId: 287]}
dalhdqasalfkpipeqvtelrgqpiseqqrelgkklffdprlsrshvlscntchnvgtg
gadnvptsvghgwqkgprnsptvfnavfnaaqfwdgrakdlgeqakgpiqnsvemhstpq
lveqtlgsipeyvdafrkafpkagkpvsfdnmalaieayeatlv
Timeline for d1eb7a1: