Lineage for d1eaja_ (1eaj A:)

  1. Root: SCOPe 2.02
  2. 1103260Class b: All beta proteins [48724] (174 folds)
  3. 1103261Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 1103262Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 1103263Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)
  6. 1103432Protein Coxsackie virus and adenovirus receptor (Car), domain 1 [48730] (1 species)
  7. 1103433Species Human (Homo sapiens) [TaxId:9606] [48731] (7 PDB entries)
  8. 1103434Domain d1eaja_: 1eaj A: [59401]
    complexed with so4

Details for d1eaja_

PDB Entry: 1eaj (more details), 1.35 Å

PDB Description: dimeric structure of the coxsackie virus and adenovirus receptor d1 domain at 1.35 angstrom resolution
PDB Compounds: (A:) coxsackie virus and adenovirus receptor

SCOPe Domain Sequences for d1eaja_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1eaja_ b.1.1.1 (A:) Coxsackie virus and adenovirus receptor (Car), domain 1 {Human (Homo sapiens) [TaxId: 9606]}
farslsittpeemiekakgetaylpckftlspedqgpldiewlispadnqkvdqviilys
gdkiyddyypdlkgrvhftsndlksgdasinvtnlqlsdigtyqckvkkapgvankkihl
vvlv

SCOPe Domain Coordinates for d1eaja_:

Click to download the PDB-style file with coordinates for d1eaja_.
(The format of our PDB-style files is described here.)

Timeline for d1eaja_: