Lineage for d1e96a_ (1e96 A:)
- Root: SCOPe 2.03
Class c: Alpha and beta proteins (a/b) [51349] (147 folds) 
Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
3 layers: a/b/a, parallel or mixed beta-sheets of variable sizesSuperfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (25 families) 
division into families based on beta-sheet topologies
Family c.37.1.8: G proteins [52592] (79 proteins)
core: mixed beta-sheet of 6 strands, order 231456; strand 2 is antiparallel to the rest
Protein Rac [52595] (1 species) Species Human (Homo sapiens) [TaxId:9606] [52596] (17 PDB entries) 
Domain d1e96a_: 1e96 A: [32007]
Other proteins in same PDB: d1e96b_
rac1
complexed with gtp, mg
Details for d1e96a_
PDB Entry: 1e96 (more details), 2.4 Å
PDB Description: structure of the rac/p67phox complex
PDB Compounds: (A:) ras-related c3 botulinum toxin substrate 1SCOPe Domain Sequences for d1e96a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1e96a_ c.37.1.8 (A:) Rac {Human (Homo sapiens) [TaxId: 9606]}
pqaikcvvvgdgavgktcllisyttnafpgeyiptvfdnysanvmvdgkpvnlglwdtag
ledydrlrplsypqtdvflicfslvspasfenvrakwypevrhhcpntpiilvgtkldlr
ddkdtieklkekkltpitypqglamakeigavkylecsaltqrglktvfdeairavlc
SCOPe Domain Coordinates for d1e96a_:
Click to download the PDB-style file with coordinates for d1e96a_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1e96a_:
- d1e96a_ first appeared (with stable ids) in SCOP 1.55
- d1e96a_ appears in SCOPe 2.02
- d1e96a_ appears in SCOPe 2.04
- d1e96a_ appears in the current release, SCOPe 2.08, called d1e96a1
View in 3D
