Lineage for d1e8ja_ (1e8j A:)

  1. Root: SCOPe 2.04
  2. 1700111Class g: Small proteins [56992] (91 folds)
  3. 1705786Fold g.41: Rubredoxin-like [57769] (17 superfamilies)
    metal(zinc or iron)-bound fold; sequence contains two CX(n)C motifs, in most cases n = 2
  4. 1705990Superfamily g.41.5: Rubredoxin-like [57802] (4 families) (S)
  5. 1705991Family g.41.5.1: Rubredoxin [57803] (5 proteins)
  6. 1706000Protein Rubredoxin [57804] (8 species)
  7. 1706034Species Desulfovibrio gigas [TaxId:879] [57806] (3 PDB entries)
  8. 1706037Domain d1e8ja_: 1e8j A: [64796]

Details for d1e8ja_

PDB Entry: 1e8j (more details)

PDB Description: solution structure of desulfovibrio gigas zinc rubredoxin, nmr, 20 structures
PDB Compounds: (A:) rubredoxin

SCOPe Domain Sequences for d1e8ja_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1e8ja_ g.41.5.1 (A:) Rubredoxin {Desulfovibrio gigas [TaxId: 879]}
mdiyvctvcgyeydpakgdpdsgikpgtkfedlpddwacpvcgaskdafekq

SCOPe Domain Coordinates for d1e8ja_:

Click to download the PDB-style file with coordinates for d1e8ja_.
(The format of our PDB-style files is described here.)

Timeline for d1e8ja_: