Lineage for d1e5ea_ (1e5e A:)
- Root: SCOPe 2.06
Class c: Alpha and beta proteins (a/b) [51349] (148 folds) 
Fold c.67: PLP-dependent transferase-like [53382] (3 superfamilies)
main domain: 3 layers: a/b/a, mixed beta-sheet of 7 strands, order 3245671; strand 7 is antiparallel to the restSuperfamily c.67.1: PLP-dependent transferases [53383] (10 families) 
Family c.67.1.3: Cystathionine synthase-like [53402] (17 proteins) Protein Methionine gamma-lyase, MGL [64126] (4 species) 
Species Trichomonas vaginalis, MGL1 [TaxId:5722] [64127] (2 PDB entries) 
Domain d1e5ea_: 1e5e A: [59265]
complexed with gol, ppj, so4
Details for d1e5ea_
PDB Entry: 1e5e (more details), 2.18 Å
PDB Description: methionine gamma-lyase (mgl) from trichomonas vaginalis in complex with propargylglycine
PDB Compounds: (A:) methionine gamma-lyaseSCOPe Domain Sequences for d1e5ea_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1e5ea_ c.67.1.3 (A:) Methionine gamma-lyase, MGL {Trichomonas vaginalis, MGL1 [TaxId: 5722]}
ermtpatacihanpqkdqfgaaippiyqtstfvfdncqqggnrfagqesgyiytrlgnpt
vsnlegkiaflekteacvatssgmgaiaatvltilkagdhlisdeclygcthalfehalt
kfgiqvdfintaipgevkkhmkpntkivyfetpanptlkiidmervckdahsqegvlvia
dntfcspmitnpvdfgvdvvvhsatkyinghtdvvaglicgkadllqqirmvgikditgs
visphdawlitrglstlnirmkaesenamkvaeylkshpavekvyypgfedheghdiakk
qmrmygsmitfilksgfegakklldnlklitlavslggcesliqhpasmthavvpkeere
aagitdgmirlsvgiedadeliadfkqgldallr
SCOPe Domain Coordinates for d1e5ea_:
Click to download the PDB-style file with coordinates for d1e5ea_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1e5ea_:
- d1e5ea_ first appeared in SCOP 1.57
- d1e5ea_ appears in SCOPe 2.05
- d1e5ea_ appears in SCOPe 2.07
- d1e5ea_ appears in the current release, SCOPe 2.08
View in 3D
