Lineage for d1e4ea1 (1e4e A:2-131)

  1. Root: SCOPe 2.05
  2. 1815291Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1842743Fold c.30: PreATP-grasp domain [52439] (1 superfamily)
    3 layers: a/b/a; parallel or mixed beta-sheet of 4 to 6 strands
    possible rudiment form of Rossmann-fold domain
  4. 1842744Superfamily c.30.1: PreATP-grasp domain [52440] (9 families) (S)
    precedes the ATP-grasp domain common to all superfamily members, can contain a substrate-binding function
  5. 1842922Family c.30.1.2: D-Alanine ligase N-terminal domain [52452] (2 proteins)
  6. 1842936Protein D-alanine:D-lactate ligase VanA, N-domain [52455] (2 species)
  7. 1842937Species Enterococcus faecium [TaxId:1352] [63983] (1 PDB entry)
  8. 1842938Domain d1e4ea1: 1e4e A:2-131 [59221]
    Other proteins in same PDB: d1e4ea2, d1e4eb2
    complexed with adp, gol, mg, phy, so4

Details for d1e4ea1

PDB Entry: 1e4e (more details), 2.5 Å

PDB Description: d-alanyl-d-lacate ligase
PDB Compounds: (A:) vancomycin/teicoplanin a-type resistance protein vana

SCOPe Domain Sequences for d1e4ea1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1e4ea1 c.30.1.2 (A:2-131) D-alanine:D-lactate ligase VanA, N-domain {Enterococcus faecium [TaxId: 1352]}
nrikvailfggcseehdvsvksaieiaaninkekyeplyigitksgvwkmcekpcaewen
encysavlspdkkmhgllvkknheyeinhvdvafsalhgksgedgsiqglfelsgipfvg
cdiqssaicm

SCOPe Domain Coordinates for d1e4ea1:

Click to download the PDB-style file with coordinates for d1e4ea1.
(The format of our PDB-style files is described here.)

Timeline for d1e4ea1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1e4ea2