Class f: Membrane and cell surface proteins and peptides [56835] (59 folds) |
Fold f.13: Class A G protein-coupled receptor (GPCR)-like [81322] (1 superfamily) core: up-and-down bundle of seven transmembrane helices tilted 20 degrees with respect to the plane of the membrane |
Superfamily f.13.1: Class A G protein-coupled receptor (GPCR)-like [81321] (5 families) Pfam PF13853. Phylogeny described in PubMed 12761335 |
Family f.13.1.1: Bacteriorhodopsin-like [81319] (6 proteins) |
Protein Halorhodopsin [56874] (1 species) a light-driven chloride pump |
Species Halobacterium salinarum [TaxId:2242] [56875] (1 PDB entry) |
Domain d1e12a_: 1e12 A: [43428] complexed with cl, k, mpg, plm, ret |
PDB Entry: 1e12 (more details), 1.8 Å
SCOPe Domain Sequences for d1e12a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1e12a_ f.13.1.1 (A:) Halorhodopsin {Halobacterium salinarum [TaxId: 2242]} renallssslwvnvalagiailvfvymgrtirpgrprliwgatlmiplvsissylgllsg ltvgmiempaghalagemvrsqwgryltwalstpmillalglladvdlgslftviaadig mcvtglaaamttsallfrwafyaiscaffvvvlsalvtdwaasassagtaeifdtlrvlt vvlwlgypivwavgveglalvqsvgatswaysvldvfakyvfafillrwvannertvav
Timeline for d1e12a_: