Lineage for d1e12a_ (1e12 A:)

  1. Root: SCOPe 2.06
  2. 2250849Class f: Membrane and cell surface proteins and peptides [56835] (59 folds)
  3. 2252282Fold f.13: Class A G protein-coupled receptor (GPCR)-like [81322] (1 superfamily)
    core: up-and-down bundle of seven transmembrane helices tilted 20 degrees with respect to the plane of the membrane
  4. 2252283Superfamily f.13.1: Class A G protein-coupled receptor (GPCR)-like [81321] (5 families) (S)
    Pfam PF13853. Phylogeny described in PubMed 12761335
  5. 2252284Family f.13.1.1: Bacteriorhodopsin-like [81319] (6 proteins)
  6. 2252399Protein Halorhodopsin [56874] (1 species)
    a light-driven chloride pump
  7. 2252400Species Halobacterium salinarum [TaxId:2242] [56875] (1 PDB entry)
  8. 2252401Domain d1e12a_: 1e12 A: [43428]
    complexed with cl, k, mpg, plm, ret

Details for d1e12a_

PDB Entry: 1e12 (more details), 1.8 Å

PDB Description: halorhodopsin, a light-driven chloride pump
PDB Compounds: (A:) halorhodopsin

SCOPe Domain Sequences for d1e12a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1e12a_ f.13.1.1 (A:) Halorhodopsin {Halobacterium salinarum [TaxId: 2242]}
renallssslwvnvalagiailvfvymgrtirpgrprliwgatlmiplvsissylgllsg
ltvgmiempaghalagemvrsqwgryltwalstpmillalglladvdlgslftviaadig
mcvtglaaamttsallfrwafyaiscaffvvvlsalvtdwaasassagtaeifdtlrvlt
vvlwlgypivwavgveglalvqsvgatswaysvldvfakyvfafillrwvannertvav

SCOPe Domain Coordinates for d1e12a_:

Click to download the PDB-style file with coordinates for d1e12a_.
(The format of our PDB-style files is described here.)

Timeline for d1e12a_: