Class d: Alpha and beta proteins (a+b) [53931] (385 folds) |
Fold d.129: TBP-like [55944] (11 superfamilies) beta-alpha-beta(4)-alpha |
Superfamily d.129.3: Bet v1-like [55961] (11 families) contains a single copy of this fold with a alpha-beta2 insertion after the first helix; there is a cavity between the beta-sheet and the long C-terminal helix |
Family d.129.3.1: Pathogenesis-related protein 10 (PR10)-like [55962] (5 proteins) |
Protein Major tree pollen allergen [55963] (4 species) |
Species Sweet cherry (Prunus avium), pru av 1 [TaxId:42229] [64387] (2 PDB entries) |
Domain d1e09a_: 1e09 A: [59146] |
PDB Entry: 1e09 (more details)
SCOPe Domain Sequences for d1e09a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1e09a_ d.129.3.1 (A:) Major tree pollen allergen {Sweet cherry (Prunus avium), pru av 1 [TaxId: 42229]} gvftyeseftseippprlfkafvldadnlvpkiapqaikhseilegdggpgtikkitfge gsqygyvkhkidsidkenysysytliegdalgdtlekisyetklvaspsggsiikstshy htkgnveikeehvkagkekasnlfklietylkghpdayn
Timeline for d1e09a_: