Lineage for d1dxrh1 (1dxr H:37-258)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2791427Fold b.41: PRC-barrel domain [50345] (1 superfamily)
    core: barrel, partly opened; n*=5, S*=8; meander
  4. 2791428Superfamily b.41.1: PRC-barrel domain [50346] (5 families) (S)
  5. 2791429Family b.41.1.1: Photosynthetic reaction centre, H-chain, cytoplasmic domain [50347] (2 proteins)
  6. 2791430Protein Photosynthetic reaction centre [50348] (4 species)
  7. 2791529Species Rhodopseudomonas viridis [TaxId:1079] [50349] (26 PDB entries)
  8. 2791541Domain d1dxrh1: 1dxr H:37-258 [25456]
    Other proteins in same PDB: d1dxrc_, d1dxrh2, d1dxrl_, d1dxrm_
    complexed with bcb, bpb, fe2, hec, lda, mq9, mst, ns5, so4; mutant

Details for d1dxrh1

PDB Entry: 1dxr (more details), 2 Å

PDB Description: photosynthetic reaction center from rhodopseudomonas viridis - his l168 phe mutant (terbutryn complex)
PDB Compounds: (H:) Photosynthetic reaction center H subunit

SCOPe Domain Sequences for d1dxrh1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1dxrh1 b.41.1.1 (H:37-258) Photosynthetic reaction centre {Rhodopseudomonas viridis [TaxId: 1079]}
rregyplveplglvklapedgqvyelpypktfvlphggtvtvprrrpetrelklaqtdgf
egaplqptgnplvdavgpasyaeraevvdatvdgkakivplrvatdfsiaegdvdprglp
vvaadgveagtvtdlwvdrsehyfrylelsvagsartaliplgfcdvkkdkivvtsilse
qfanvprlqsrdqitlreedkvsayyaggllyatperaesll

SCOPe Domain Coordinates for d1dxrh1:

Click to download the PDB-style file with coordinates for d1dxrh1.
(The format of our PDB-style files is described here.)

Timeline for d1dxrh1: