Class g: Small proteins [56992] (100 folds) |
Fold g.50: FYVE/PHD zinc finger [57902] (2 superfamilies) dimetal(zinc)-bound alpha+beta fold |
Superfamily g.50.1: FYVE/PHD zinc finger [57903] (4 families) |
Family g.50.1.1: FYVE, a phosphatidylinositol-3-phosphate binding domain [57904] (6 proteins) |
Protein Hrs [57907] (1 species) protein involved in membrane trafficking and signal transduction |
Species Fruit fly (Drosophila melanogaster) [TaxId:7227] [57908] (1 PDB entry) |
Domain d1dvpa2: 1dvp A:149-220 [45358] Other proteins in same PDB: d1dvpa1 complexed with cit, zn |
PDB Entry: 1dvp (more details), 2 Å
SCOPe Domain Sequences for d1dvpa2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1dvpa2 g.50.1.1 (A:149-220) Hrs {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} mftadtapnwadgrvchrcrveftftnrkhhcrncgqvfcgqctakqcplpkygiekevr vcdgcfaalqrg
Timeline for d1dvpa2: