Class d: Alpha and beta proteins (a+b) [53931] (381 folds) |
Fold d.79: Bacillus chorismate mutase-like [55297] (9 superfamilies) core: beta-alpha-beta-alpha-beta(2); mixed beta-sheet: order: 1423, strand 4 is antiparallel to the rest |
Superfamily d.79.3: L30e-like [55315] (4 families) |
Family d.79.3.2: ERF1/Dom34 C-terminal domain-like [55323] (3 proteins) automatically mapped to Pfam PF03465 |
Protein C-terminal domain of eukaryotic peptide chain release factor subunit 1, ERF1 [55324] (1 species) contains a large insertion forming a separate (sub)domain |
Species Human (Homo sapiens) [TaxId:9606] [55325] (1 PDB entry) |
Domain d1dt9a2: 1dt9 A:277-422 [39815] Other proteins in same PDB: d1dt9a1, d1dt9a3 |
PDB Entry: 1dt9 (more details), 2.7 Å
SCOPe Domain Sequences for d1dt9a2:
Sequence, based on SEQRES records: (download)
>d1dt9a2 d.79.3.2 (A:277-422) C-terminal domain of eukaryotic peptide chain release factor subunit 1, ERF1 {Human (Homo sapiens) [TaxId: 9606]} nvkfiqekkligryfdeisqdtgkycfgvedtlkalemgaveilivyenldimryvlhcq gteeekilyltpeqekdkshftdketgqeheliesmpllewfannykkfgatleivtdks qegsqfvkgfggiggilryrvdfqgm
>d1dt9a2 d.79.3.2 (A:277-422) C-terminal domain of eukaryotic peptide chain release factor subunit 1, ERF1 {Human (Homo sapiens) [TaxId: 9606]} nvkfiqekkligryfdeisqdtgkycfgvedtlkalemgaveilivyenldimryvlily ltpeqekdkshftesmpllewfannykkfgatleivtdksqegsqfvkgfggiggilryr vdfqgm
Timeline for d1dt9a2: