Class d: Alpha and beta proteins (a+b) [53931] (385 folds) |
Fold d.44: Fe,Mn superoxide dismutase (SOD), C-terminal domain [54718] (1 superfamily) alpha-beta(2)-alpha-beta-alpha(2); 3 strands of antiparallel sheet: 213 |
Superfamily d.44.1: Fe,Mn superoxide dismutase (SOD), C-terminal domain [54719] (2 families) automatically mapped to Pfam PF02777 |
Family d.44.1.1: Fe,Mn superoxide dismutase (SOD), C-terminal domain [54720] (4 proteins) |
Protein Fe superoxide dismutase (FeSOD) [54725] (10 species) |
Species Pseudomonas ovalis [TaxId:303] [54726] (2 PDB entries) |
Domain d1dt0a2: 1dt0 A:84-197 [38719] Other proteins in same PDB: d1dt0a1, d1dt0b1, d1dt0c1 complexed with fe |
PDB Entry: 1dt0 (more details), 2.1 Å
SCOPe Domain Sequences for d1dt0a2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1dt0a2 d.44.1.1 (A:84-197) Fe superoxide dismutase (FeSOD) {Pseudomonas ovalis [TaxId: 303]} aggqptgaladainaafgsfdkfkeeftktsvgtfgsgwgwlvkkadgslalastigagc pltigdtplltcdvwehayyidyrnlrpkyveafwnlvnwafvaeqfegktykv
Timeline for d1dt0a2:
View in 3D Domains from other chains: (mouse over for more information) d1dt0b1, d1dt0b2, d1dt0c1, d1dt0c2 |