Lineage for d1dn1b_ (1dn1 B:)
- Root: SCOPe 2.08
Class a: All alpha proteins [46456] (290 folds) 
Fold a.47: STAT-like [47654] (6 superfamilies)
4 long helices; bundle, left-handed twist (coiled coil); right-handed superhelixSuperfamily a.47.2: t-snare proteins [47661] (1 family) 
Family a.47.2.1: t-snare proteins [47662] (6 proteins) Protein automated matches [191190] (5 species)
not a true protein
Species Rattus norvegicus [311131] (1 PDB entry) 
Domain d1dn1b_: 1dn1 B: [302344]
Other proteins in same PDB: d1dn1a_
automated match to d3c98b_
Details for d1dn1b_
PDB Entry: 1dn1 (more details), 2.6 Å
PDB Description: Crystal structure of the neuronal-sec1/syntaxin 1a complex
PDB Compounds: (B:) syntaxin 1aSCOPe Domain Sequences for d1dn1b_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1dn1b_ a.47.2.1 (B:) automated matches {Rattus norvegicus}
drfmdeffeqveeirgfidkiaenveevkrkhsailaspnpdektkeeleelmsdikkta
nkvrsklksieqsieqeeglnrssadlrirktqhstlsrkfvevmseynatqsdyrerck
griqrqleitgrtttseeledmlesgnpaifasgiimdssiskqalseietrhseiikle
nsirelhdmfmdmamlvesqgemidrieynvehavdyverav
SCOPe Domain Coordinates for d1dn1b_:
Click to download the PDB-style file with coordinates for d1dn1b_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1dn1b_:
- d1dn1b_ first appeared in SCOPe 2.06
- d1dn1b_ appears in SCOPe 2.07
View in 3D
