SCOPe 2.05: Domain d1dn0b1: 1dn0 B:1-120

Lineage for d1dn0b1 (1dn0 B:1-120)

Root: SCOPe 2.05
Class b: All beta proteins [48724] (176 folds)
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies)
sandwich; 7 strands in 2 sheets; greek-key
some members of the fold have additional strands
Superfamily b.1.1: Immunoglobulin [48726] (5 families)
Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)

Protein Immunoglobulin heavy chain variable domain, VH [88543] (21 species)
VH domains of human and mouse antibodies are clustered by the sequence similarity within the germline encoded segment and then by the size of the complementarity determining regions CDR1 and CDR2, so the clusters may correspond to putative germline families in the species genomes; VH domains with artificial or grafted exogenous CDRs are listed as engineered species

Species Human (Homo sapiens), cluster 2.1 [TaxId:9606] [88545] (3 PDB entries)
Domain d1dn0b1: 1dn0 B:1-120 [19831]
Other proteins in same PDB: d1dn0a1, d1dn0a2, d1dn0b2, d1dn0c1, d1dn0c2, d1dn0d2
part of Fab Kau cold agglutinin IgM

Details for d1dn0b1

PDB Entry: 1dn0 (more details), 2.28 Å

PDB Description: structure of the fab fragment from a human igm cold agglutinin

PDB Compounds: (B:) igm-kappa cold agglutinin (heavy chain)

SCOPe Domain Sequences for d1dn0b1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1dn0b1 b.1.1.1 (B:1-120) Immunoglobulin heavy chain variable domain, VH {Human (Homo sapiens), cluster 2.1 [TaxId: 9606]}
evqlqqwgagllkpsetlsltcavyggsfsdyywswirqppgkglewigeinhsgstnyn
pslksrvtisvdtsknqfslklssvtaadtavyycarpphdtsghywnywgqgtlvtvss

SCOPe Domain Coordinates for d1dn0b1:

Click to download the PDB-style file with coordinates for d1dn0b1.
(The format of our PDB-style files is described here.)

Timeline for d1dn0b1: