Lineage for d1dmta_ (1dmt A:)

  1. Root: SCOPe 2.01
  2. 1013083Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1034471Fold d.92: Zincin-like [55485] (2 superfamilies)
    contains mixed beta sheet with connection over free side of the sheet
  4. 1034472Superfamily d.92.1: Metalloproteases ("zincins"), catalytic domain [55486] (18 families) (S)
  5. 1034559Family d.92.1.4: Neutral endopeptidase (neprilysin) [55502] (2 proteins)
  6. 1034560Protein Neutral endopeptidase (neprilysin) [55503] (1 species)
    contains thermolysin-like catalytic domain (residues 419-749)
    the N-terminal half of the structure is multihelical
  7. 1034561Species Human (Homo sapiens) [TaxId:9606] [55504] (6 PDB entries)
    Uniprot P08473 54-749
  8. 1034563Domain d1dmta_: 1dmt A: [40296]
    complexed with gol, nag, rdf, zn

Details for d1dmta_

PDB Entry: 1dmt (more details), 2.1 Å

PDB Description: structure of human neutral endopeptidase complexed with phosphoramidon
PDB Compounds: (A:) neutral endopeptidase

SCOPe Domain Sequences for d1dmta_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1dmta_ d.92.1.4 (A:) Neutral endopeptidase (neprilysin) {Human (Homo sapiens) [TaxId: 9606]}
gickssdciksaarliqnmdattepctdffkyacggwlkrnvipetssrygnfdilrdel
evvlkdvlqepktedivavqkakalyrscinesaidsrggepllkllpdiygwpvatenw
eqkygaswtaekaiaqlnskygkkvlinlfvgtddknsvnhvihidqprlglpsrdyyec
tgiykeactayvdfmisvarlirqeerlpidenqlalemnkvmelekeianatakpedrn
dpmllynkmtlaqiqnnfsleingkpfswlnftneimstvnisitneedvvvyapeyltk
lkpiltkysardlqnlmswrfimdlvsslsrtykesrnafrkalygttsetatwrrcany
vngnmenavgrlyveaafageskhvvedliaqirevfiqtlddltwmdaetkkraeekal
aikerigypddivsndnklnneylelnykedeyfeniiqnlkfsqskqlkklrekvdkde
wisgaavvnafyssgrnqivfpagilqppffsaqqsnslnyggigmvigheithgfddng
rnfnkdgdlvdwwtqqsasnfkeqsqcmvyqygnfswdlaggqhlngintlgeniadngg
lgqayrayqnyikkngeekllpgldlnhkqlfflnfaqvwcgtyrpeyavnsiktdvhsp
gnfriigtlqnsaefseafhcrknsymnpekkcrvw

SCOPe Domain Coordinates for d1dmta_:

Click to download the PDB-style file with coordinates for d1dmta_.
(The format of our PDB-style files is described here.)

Timeline for d1dmta_: