Lineage for d1dlwa_ (1dlw A:)

  1. Root: SCOPe 2.05
  2. 1715731Class a: All alpha proteins [46456] (286 folds)
  3. 1715732Fold a.1: Globin-like [46457] (2 superfamilies)
    core: 6 helices; folded leaf, partly opened
  4. 1715733Superfamily a.1.1: Globin-like [46458] (5 families) (S)
  5. 1715734Family a.1.1.1: Truncated hemoglobin [46459] (2 proteins)
    lack the first helix (A)
  6. 1715735Protein Protozoan/bacterial hemoglobin [46460] (6 species)
  7. 1715738Species Ciliate (Paramecium caudatum) [TaxId:5885] [46461] (2 PDB entries)
  8. 1715739Domain d1dlwa_: 1dlw A: [14982]
    complexed with hem

Details for d1dlwa_

PDB Entry: 1dlw (more details), 1.54 Å

PDB Description: x-ray crystal structure of truncated hemoglobin from p.caudatum.
PDB Compounds: (A:) hemoglobin

SCOPe Domain Sequences for d1dlwa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1dlwa_ a.1.1.1 (A:) Protozoan/bacterial hemoglobin {Ciliate (Paramecium caudatum) [TaxId: 5885]}
slfeqlggqaavqavtaqfyaniqadatvatffngidmpnqtnktaaflcaalggpnawt
grnlkevhanmgvsnaqfttvighlrsaltgagvaaalveqtvavaetvrgdvvtv

SCOPe Domain Coordinates for d1dlwa_:

Click to download the PDB-style file with coordinates for d1dlwa_.
(The format of our PDB-style files is described here.)

Timeline for d1dlwa_: