Lineage for d1djsa1 (1djs A:147-250)
- Root: SCOPe 2.06
Class b: All beta proteins [48724] (177 folds) 
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
sandwich; 7 strands in 2 sheets; greek-key
some members of the fold have additional strands
Superfamily b.1.1: Immunoglobulin [48726] (5 families) 
Family b.1.1.4: I set domains [49159] (39 proteins) 
Protein Fibroblast growth factor receptor, FGFR [49179] (4 species) Species Human (Homo sapiens), FGFR2a [TaxId:9606] [49181] (11 PDB entries) 
Domain d1djsa1: 1djs A:147-250 [21746]
Other proteins in same PDB: d1djsb_
complexed with so4
Details for d1djsa1
PDB Entry: 1djs (more details), 2.4 Å
PDB Description: ligand-binding portion of fibroblast growth factor receptor 2 in complex with fgf1
PDB Compounds: (A:) protein (fibroblast growth factor receptor 2)SCOPe Domain Sequences for d1djsa1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1djsa1 b.1.1.4 (A:147-250) Fibroblast growth factor receptor, FGFR {Human (Homo sapiens), FGFR2a [TaxId: 9606]}
tlepegapywtntekmekrlhavpaantvkfrcpaggnpmptmrwlkngkefkqehrigg
ykvrnqhwslimesvvpsdkgnytcvveneygsinhtyhldvve
SCOPe Domain Coordinates for d1djsa1:
Click to download the PDB-style file with coordinates for d1djsa1.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1djsa1:
- d1djsa1 first appeared (with stable ids) in SCOP 1.55
- d1djsa1 appears in SCOPe 2.05
- d1djsa1 appears in SCOPe 2.07
- d1djsa1 appears in the current release, SCOPe 2.08
View in 3D
