| Class b: All beta proteins [48724] (177 folds) |
| Fold b.40: OB-fold [50198] (16 superfamilies) barrel, closed or partly opened n=5, S=10 or S=8; greek-key |
Superfamily b.40.2: Bacterial enterotoxins [50203] (3 families) ![]() |
| Family b.40.2.1: Bacterial AB5 toxins, B-subunits [50204] (7 proteins) |
| Protein Heat-labile toxin [50205] (2 species) |
| Species Escherichia coli, type IB [TaxId:562] [50206] (22 PDB entries) |
| Domain d1djrd_: 1djr D: [24865] complexed with bez, gla, gol |
PDB Entry: 1djr (more details), 1.3 Å
SCOPe Domain Sequences for d1djrd_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1djrd_ b.40.2.1 (D:) Heat-labile toxin {Escherichia coli, type IB [TaxId: 562]}
apqtitelcseyrntqiytindkilsytesmagkremviitfksgetfqvevpgsqhids
qkkaiermkdtlrityltetkidklcvwnnktpnsiaaismkn
Timeline for d1djrd_:
View in 3DDomains from other chains: (mouse over for more information) d1djre_, d1djrf_, d1djrg_, d1djrh_ |